Page tree
Skip to end of metadata
Go to start of metadata

Sequence length: 806 aa
Organism: 
Methanosarcina thermophila
Gene: cdhA1

Uniprot ID: Q08368 (ACDA1_METTE)

Annotation score: 4

Protein name: Acetyl-CoA decarbonylase/synthase complex subunit alpha 1


Function: Part of the ACDS complex that catalyzes the reversible cleavage of acetyl-CoA, allowing growth on acetate as sole source of carbon and energy. The alpha-epsilon subcomponent functions as a carbon monoxide dehydrogenase.


Position in genome: n/a

Nucleotide sequence: n/a


Amino acid sequence: 806 aa

MSKLTTGSFSIEDLESVQITINNVIGAAKEAADEKAKDLGPMGPSAWPGLATYRDDWNLK
LLDRYEPVITPMCDQCCYCTYGPCDLSNNKRGACGIDMLGHNGREFFLRVITGTACHAAH
GRHLLDHLIEVFGEDLPLKLGQSDVLTPNITITTGQRPMTLGEIKPAMEHTEEQLTQLLA
TVHAGQESAEIDYDSKALFSGSLDHVGMEISDIVQIAALDFPKADPEAPLIEMGVGTIDK
EKPFLCVIGHNVGGVTYMMDYMEEHDLTGKMELGGLCCTAIDLTRYKEADRRAPYTKVIG
SMSQELKIIRSGLPDVIVVDEQCVRGDIVPEAQKLGIPVIASNAKIMYGLPNRDEQDVDA
TIEELKSGAIPGAVILDYDKLGEISVRLTQEMHPLREAAGLRKIASDEQMKEWVDKCADC
GSCYLVCPEELEIPEAMKHAKEGDYSYLVDLHDQCIGCRRCEQVCKKEIPILSVIEKASQ
KVIAEEKGWMRAGRGQVSDAEIRAEGLNLVMGTTPGIIAIIGCPNYGDGAKSVYYIAEEF
LKRNFIVVGTGCGAMDMGMYKDENGQTLYERFPGGFQSGGLVNIGSCVSNAHITGAAQKV
AGIFGGRTMEGNLAEIADYVLNRVGACGLAWGAFSQKASSIGTGCNIYGIPAVLGPHSSK
YRRALISKNYDDEKWKVYDARSGEEMAIPPAPEFLLITAETWQEAIPMMAKACIRPSDNS
MGRSIKLTHWMELHQKYIGGMPEDWWKFIRTEADLPLAKRAELMKKLEEEHGWEIDWKRK
KIISGPKIKFDVSAQPTNLKRLCKGA



3D model(s): cdhA1.pdb

Modelling software: Phyre2. Pictures taken by ChimeraX

Notes: Sequence coverage: 95%



References: 

UniProt search term: Methanosarcina thermophila IPR017896 AND reviewed:yes


  • No labels