Page tree

Versions Compared

Key

  • This line was added.
  • This line was removed.
  • Formatting was changed.
Excerpt
Sequence length: 806 aa
Organism: 
Methanosarcina thermophila
Gene: MF_01137 (cdhA1)


Uniprot ID: Q08368 (ACDA1_METTE)

Annotation score: 4

Protein name: Acetyl-CoA decarbonylase/synthase complex subunit alpha 1


Function: Part of the ACDS complex that catalyzes the reversible cleavage of acetyl-CoA, allowing growth on acetate as sole source of carbon and energy. The alpha-epsilon subcomponent functions as a carbon monoxide dehydrogenase.


Position in genome:

Nucleotide sequence:


Amino acid sequence: 806 aa

MSKLTTGSFSIEDLESVQITINNVIGAAKEAADEKAKDLGPMGPSAWPGLATYRDDWNLK
LLDRYEPVITPMCDQCCYCTYGPCDLSNNKRGACGIDMLGHNGREFFLRVITGTACHAAH
GRHLLDHLIEVFGEDLPLKLGQSDVLTPNITITTGQRPMTLGEIKPAMEHTEEQLTQLLA
TVHAGQESAEIDYDSKALFSGSLDHVGMEISDIVQIAALDFPKADPEAPLIEMGVGTIDK
EKPFLCVIGHNVGGVTYMMDYMEEHDLTGKMELGGLCCTAIDLTRYKEADRRAPYTKVIG
SMSQELKIIRSGLPDVIVVDEQCVRGDIVPEAQKLGIPVIASNAKIMYGLPNRDEQDVDA
TIEELKSGAIPGAVILDYDKLGEISVRLTQEMHPLREAAGLRKIASDEQMKEWVDKCADC
GSCYLVCPEELEIPEAMKHAKEGDYSYLVDLHDQCIGCRRCEQVCKKEIPILSVIEKASQ
KVIAEEKGWMRAGRGQVSDAEIRAEGLNLVMGTTPGIIAIIGCPNYGDGAKSVYYIAEEF
LKRNFIVVGTGCGAMDMGMYKDENGQTLYERFPGGFQSGGLVNIGSCVSNAHITGAAQKV
AGIFGGRTMEGNLAEIADYVLNRVGACGLAWGAFSQKASSIGTGCNIYGIPAVLGPHSSK
YRRALISKNYDDEKWKVYDARSGEEMAIPPAPEFLLITAETWQEAIPMMAKACIRPSDNS
MGRSIKLTHWMELHQKYIGGMPEDWWKFIRTEADLPLAKRAELMKKLEEEHGWEIDWKRK
KIISGPKIKFDVSAQPTNLKRLCKGA



3D model(s):

Modelling software:


Notes:



References: 

UniProt search (Methanosarcina thermophila IPR017896)