Page tree
Skip to end of metadata
Go to start of metadata

Sequence length: 409 aa
Organism: 
Methanosarcina thermophila (strain ATCC 43570 / DSM 1825 / OCM 12 / VKM B-1830 / TM-1)
Gene: MSTHT_2244 (hdrD)

Uniprot ID: A0A0E3NEE1(HDRD_METTT)

Annotation score: 4

Protein name: Dihydromethanophenazine:CoB--CoM heterodisulfide reductase subunit D


Function: Part of a complex that catalyzes the reversible reduction of CoM-S-S-CoB to the thiol-coenzymes H-S-CoM (coenzyme M) and H-S-CoB (coenzyme B). Electrons probably transfer from phenazine to the high potential 4Fe cluster in HdrD subunit, then to the low potential heme in HdrE subunit and finally to CoM-S-S-CoB

Position in genome: 2732225..2733454


Nucleotide sequence: 1230 nt

atggcaaaacgtaacccttcaatcgatacaaagaatctcactgcagtccagcttatggaa
cttgatgcctgtgttcgctgcggtgaatgtgtaaaatggtgtccaacttatgccgcttct
ggcgagaagccaggattagcccctagagacaagatcctgcgctggaggcaatacatgaac
aagtcctacggacttaaggcaaggctctttggtccgcaggaaatcccaatttcagagctt
gaagaattcaaggatgatgtgcacggctgtactacctgcggtatctgttcaactgtctgt
gaagcaggcattaacaccgtggaactctgggaatctatgagagcaaaccttgtaaagaaa
ggtataggtccttatgggaagcagaacatgttcccgaaacttattgggcagtaccgcaac
ccttacatgaaggatcaaaaagacaggcttgcctgggttcccccagatgtgaaaattgaa
gacaaagccgatattgtctacttcaccggctgtactgcaggatataatcagctcgcctta
gcctttgcgacctcacgtgtgctcaacaaactgggtattaagtttgctatgcttggtgaa
gatgaatggtgctgtggctcagcccttatcaggacaggtcaggcacatatcaataacgtg
ccctacgaacttgcgaaacacaatgttgaagctatccagaagaagggtgccaagaaggtc
ctttttgcatgtgcaggttgtttccgcgctgcaaaggtcgactggcccaggcttctcggc
aaagagctgccttttgaggttgtccacgtttcagagttccttgcaggcttgataaaagaa
ggcaaaattaaatgggagaagtctattaacaagaccgttacttaccacgacccctgccac
cttggccgtcacgtaggcgtctttgatgcccccagatatgtgctatcccacattccaggt
gttaagtttgtcgagatggacagaataaaagaattccagcgctgctgtggagctggcggt
ggtgtaaaggcaggtctccctgatcttgctatggcagtcgcagaatccagggttaaggat
gctcttgataccaaggcagatatcctttccagctgctgcccattctgtaagagaaacctg
atggatggtcgggactcactcaaagttgaccttgttgtcgaggacgtcattgagcttgtt
gcagaggctctgaaccttgagactaaataa


Amino acid sequence:  409 aa

MAKRNPSIDTKNLTAVQLMELDACVRCGECVKWCPTYAASGEKPGLAPRDKILRWRQYMN
KSYGLKARLFGPQEIPISELEEFKDDVHGCTTCGICSTVCEAGINTVELWESMRANLVKK
GIGPYGKQNMFPKLIGQYRNPYMKDQKDRLAWVPPDVKIEDKADIVYFTGCTAGYNQLAL
AFATSRVLNKLGIKFAMLGEDEWCCGSALIRTGQAHINNVPYELAKHNVEAIQKKGAKKV
LFACAGCFRAAKVDWPRLLGKELPFEVVHVSEFLAGLIKEGKIKWEKSINKTVTYHDPCH
LGRHVGVFDAPRYVLSHIPGVKFVEMDRIKEFQRCCGAGGGVKAGLPDLAMAVAESRVKD
ALDTKADILSSCCPFCKRNLMDGRDSLKVDLVVEDVIELVAEALNLETK


3D model(s): hdrD.pdb

Modelling software: Phyre2, intensive mode

Notes:

100% of residues modelled at >90% confidence


References: 

UniProtKB - A0A0E3NEE1 (HDRD_METTT) https://www.uniprot.org/uniprot/A0A0E3NEE1 

KEGG https://www.genome.jp/dbget-bin/www_bget?mthr:MSTHT_2244

  • No labels